ⓘ Free online encyclopedia. Did you know? page 661


Пасош Саудијске Арабије

Пасош Саудијске Арабије је јавна путна исправа која се држављанину Саудијске Арабије издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитет ...


Пасош Северне Кореје

Пасош Северне Кореје је јавна путна исправа која се држављанину Северне Кореје издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и ка ...


Пасош Северне Македоније

Пасош Северне Македоније је јавна путна исправа која се македонском држављанину издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и к ...


Пасош Сингапура

Пасош Сингапура је јавна путна исправа која се сингапурском држављанину издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ ...


Пасош Сирије

Пасош Сирије је јавна путна исправа која се држављанину Сирије издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о држављ ...


Пасош Словачке

Пасош Словачке је јавна путна исправа која се држављанину Словачке издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и држављанства. ...


Пасош Словеније

Пасош Републике Словеније је јавна путна исправа која се држављанину Словеније издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и ка ...


Пасош Судана

Пасош Судана је јавна путна исправа која се држављанину Судана издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о држављ ...


Пасош Таџикистана

Пасош Таџикистана је јавна путна исправа која се држављанину Таџикистана издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као дока ...


Пасош Тринидада и Тобага

Пасош Тринидада и Тобага је јавна путна исправа која се држављанину Тринидада и Тобага издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентит ...


Пасош Туниса

Пасош Туниса је јавна путна исправа која се држављанину Туниса издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о држављ ...


Пасош Туркменистана

Пасош Туркменистана је јавна путна исправа која се држављанину Туркменистана издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и држа ...


Пасош Узбекистана

Пасош Узбекистана је јавна путна исправа која се држављанину Узбекистана издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као дока ...


Пасош Уједињеног Краљевства

Пасош Уједињеног Краљевства је јавна путна исправа која се британскоме држављанину издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета ...


Пасош Украјине

Пасош Републике Украјине је јавна путна исправа која се украјинскоме држављанину издаје за путовање и боравак у иностранству, као и за повратак у државу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и ...


Пасош Уругваја

Пасош Уругваја је јавна путна исправа која се држављанину Уругваја издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о др ...


Пасош Финске

Пасош Финске је јавна путна исправа која се држављанину Финске издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о држављ ...


Пасош Француске

Пасош Француске је јавна путна исправа која се држављанину Француске издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о ...


Пасош Хаитија

Пасош Хаитија је јавна путна исправа која се држављанину Хаитија издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о држа ...


Пасош Холандије

Пасош Холандије је јавна путна исправа која се држављанину Холандије издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о ...


Пасош Хондураса

Пасош Хондураса је јавна путна исправа која се држављанину Хондураса издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о ...


Пасош Чилеа

Пасош Чилеа је јавна путна исправа која се држављанину Чилеа издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о држављан ...


Пасош Шведске

Пасош Шведске је јавна путна исправа која се држављанину Шведске издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета држављанства Шведс ...


Пасош Шри Ланке

Пасош Шри Ланке је јавна путна исправа која се држављанину Шри Ланке издаје за путовање и боравак у иностранству, као и за повратак у земљу. За време боравка у иностранству, путна исправа служи њеном имаоцу за доказивање идентитета и као доказ о ...


Џеладин-паша Зогољ

Џеладин-паша Зогољ био је кајмакам у селу Зогољ, Област Мат, Албанија, Османско царство. Отац је Џелала-паше Зогоља, а дјед албанског краља Зога I од Албаније. Српског су поријекла, потомци Станка Црнојевића из племена и села Бушат код Скадра. Пр ...


Џелал-паша Зогољ

Џелал-паша Зогољ био је кајмакам у селу Зогољ, Област Мат, Албанија, Османско царство. У вријеме турске владавине, у доба Ивана Јастребова, село Зогољ је било главно мјесто бајрака Зогољ и главно мјесто у Мату. Од свих 19 села бајрака, Зогољ је и ...


Осман-паша Скопљак

Осман-паша Скопљак је био скадарски везир и син београдског везира, након Првог српског устанка - Сулејман-паше Скопљака. Словенског је поријекла: из Ускопља код Бугојна. Послије командовања дунавском тврђавом Адом Кале, за скадарског везира је п ...


Мехмед Шукри-паша

Мехмед Шукри-паша био је официр Отоманске султанове војске, војсковођа, најпознатији по томе што је турску војску предводио у периоду опсаде Једрена, једне од најважнијих битака Првог балканског рата.


Miloš Brkić (pevač)

Roden je 15. avgusta 1991. u Novom Sadu. Završio je srednju muzičku školu "Isidor Bajić" u Novom Sadu. Pored pevanja, svira i nekoliko instrumenata kao što su gitara, klavir i harmonika. Već nekoliko godina svira po klubovima u Novom Sadu i okoli ...


Borislav Zorić Ličanin

Borislav Zorić Ličanin je srpski pjevač iz Like. Pjeva narodne ličke pjesme uz harmoniku, a tokom ratova raspada SFRJ pjevao je i borbene pjesme u kojima je slavio Republiku Srpsku Krajinu. Prije rata pjevao je na jekavici, a onda je prešao na ek ...


Nedo Kostić

Nedeljko Nedo Kostić je srpski pevač narodne muzike i voditelj na TV Duga SAT. Poznat je po ratnim srpskim patriotskim i rodoljubivim pesmama. Roden je u okolini Drvara gde je živeo do početka rata.


Brane Paić

Brane Paić je srpski pjevač porijeklom sa Korduna. Život provodi u inostranstvu, ponajviše u Srbiji i na turnejama širom srpske dijaspore. Smatraju ga najboljim glasom krajiške muzike.


Саво Радусиновић

Појавио се на естрадној сцени Србије и Југославије средином седамдесетих година. Већ 1978. године снимио је један од својих највећих хитова "Шеснаест ти лета беше”. Његове албуме и синглице су објавиле музичке куће Југотон и ПГП РТБ. Најпознатије ...


Пежо тип 173

Пежо тип 173 је моторно возило произведено између 1922. и 1925 године од стране француског произвођача аутомобила Пежо у њиховој фабрици у Болијеу. У том периоду је произведено 1002 јединице. Овај модел је заменио прослављени тип 163 који је и са ...


Corpus cavernosum penis

Corpus cavernosum penis je jedan od para sunderu sličnih regiona erektilnog tkiva, corpora cavernosa, koja sadrže najveći deo krvi u penisu tokom erekcije. Takvo tkivo je homologno sa ženskim corpus cavernosum clitoridis; telo klitorisa sadrži er ...


Glukagonu sličan peptid-2

Glukagonu sličan peptid-2 je 33 aminokiseline dug peptid čija sekvenca kod ljudi je HADGSFSDEMNTILDNLAARDFINWLIQTKITD. GLP-2 se formira putem specifičnog posttranslacionog proteolitičkog presecanja proglukagona u procesu kojim se takode formira s ...


Peptidni hormon

Peptidni hormoi su klasa peptida koji se izlučuju u krvotok i imaju endokrine funkcije kod žuvotinja. Poput drugih proteina, peptidni hormoni su sintetisani u ćelijama iz aminokiselina na osnovu iRNK šablona. Prekursori peptidnih hormona pre-proh ...


Periodične publikacije

Periodične publikacije su publikacije koje izlaze u više svesaka radi informiranja javnosti o nekoj tematici. Izlaženje im nije vremenski odredeno. Zasnivaju se s namerom da izlaze u beskonačnom broju svesaka, a prestaju s izlaženjem zbog različi ...


Sefardska periodika na tlu bivše Jugoslavije

Sefardska periodika na tlu bivše Jugoslavije je skup dela koja se bave sefardskom kulturom uopšte, koja je danas značajna za proučavanje jevrejsko-španskog, kao jezika koji polako iščezava.


C1 domen

C1 domen vezuje važan sekundarni glasnik diacilglicerol, kao i analogne forbolne estere. Forbolni estri mogu da direktno stimulišu proteinsku kinazu C, PKC. N-terminal region PKC-a, poznat kao C1, je prikazan. Forbolni esteri poput PMA su analozi ...


C2 domen

C2 domen je proteinski strukturni domen koji učestvuje u sortiranju proteina do ćelijskih membrana. On je beta-sendvič koji se sastoji od osam β-ravni, koje su koordinirane sa dva do tri jona kalcijuma. Oni se vezuju u šupljinu formiranu prvom i ...


EF ruka

EF ruka je heliks-zavoj-heliks strukturni domen prisutan u velikom broju familija proteina koji vezuju kalcijum. Motiv EF ruke sadrži heliks-zavoj-heliks topologiju, slično raširenom palcu i kažiprstu ljudske ruke, u kome su Ca 2+ joni koordinira ...


Kringl domen

Kringl domeni su autonomni proteinski domeni koji formiraju velike petlje stabilizovane sa 3 disulfidne veze. Oni učestvuju u protein-protein interakcijama sa krvnim koagulacionim faktorima. Ime kringl potiče od skandinavskog peciva na koje ove s ...


Prokariotska fosfolipaza A2

Prokariotska fosfolipaza A2 je proteinski domen prisutan kod bakterijskih i fungalnih fosfolipaza. On omogućava oslobadanje masnih kiselina i lizofosfolipida putem hidrolize 2-estarske veze 1.2-diacil-3-sn-fosfoglicerida. Ovaj domena poprima alfa ...


PX domen

PX domen je strukturni domen koji vezuje fosfoinozitid i učestvuje u sortiranju proteina ka ćelijskoj membrani. Ovaj domen je prvo bio otkriven u P40phox i p47phox domenima NADPH oksidaza phox označava fagocitnu oksidazu. On je takode identifikov ...


RoGEF domen

Sledeći ljudski proteini koji sadrže ovaj domen: ABR; AKAP13; ARHGEF1; ARHGEF10; ARHGEF10L; ARHGEF11; ARHGEF12; ARHGEF15; ARHGEF16; ARHGEF17; ARHGEF18; ARHGEF19; ARHGEF2; ARHGEF3; ARHGEF4; ARHGEF5; ARHGEF6; ARHGEF7; ARHGEF9; ASEF2; BCR; C9orf100; ...



Kresta je mali perjani deo koji se nalazi na vrhu glave ptica. One su u mogućnosti da ga spuštaju i podižu. Može biti raznih boja u zavisnosti odpigmentacije ptice. Papagaji koji je imaju su nimfe i kakadui.



Азармидохт била је сасанидска краљица у Ирану од 630. до 631. године. Била је ћерка краља Хозроја II. Била је друга сасанидска краљица; пре и после ње владала је њена сестра Боран. Азармидохт је дошао на власт у Ирану након што је њеног рођака Ша ...


Хормизд I

Хормизд I је био цар Персијског царства Сасанидске династије. Био је син краља Шапура I 270/272 - 273. После персијског освајања Јерменског краљевства његов отац краљ Шапур I га је поставио 253. године за краља новоосвојене краљевине. У том рату ...


Mitridat I od Partski

Mitridat I Partski, takode poznat kao Mitridat I Veliki, bio je kralj Partskog carstva od 171. godine p.n.e. do 132. godine p.n.e. Za vreme njegove vladavine, Partija je pretvorena iz malog kraljevstva u glavnu političku silu na Drevnom Istoku. O ...